REEP1 antibody (70R-7241)

Rabbit polyclonal REEP1 antibody raised against the middle region of REEP1

Synonyms Polyclonal REEP1 antibody, Anti-REEP1 antibody, C2orf23 antibody, SPG31 antibody, REEP-1 antibody, REEP-1, REEP 1 antibody, Receptor Accessory Protein 1 antibody, REEP1, FLJ13110 antibody, REEP 1
Specificity REEP1 antibody was raised against the middle region of REEP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen REEP1 antibody was raised using the middle region of REEP1 corresponding to a region with amino acids AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI
Assay Information REEP1 Blocking Peptide, catalog no. 33R-1288, is also available for use as a blocking control in assays to test for specificity of this REEP1 antibody


Western Blot analysis using REEP1 antibody (70R-7241)

REEP1 antibody (70R-7241) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of REEP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using REEP1 antibody (70R-7241) | REEP1 antibody (70R-7241) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors