REEP4 antibody (70R-7356)

Rabbit polyclonal REEP4 antibody raised against the N terminal of REEP4

Synonyms Polyclonal REEP4 antibody, Anti-REEP4 antibody, Receptor Accessory Protein 4 antibody, REEP 4 antibody, REEP 4, REEP4, C8orf20 antibody, FLJ22246 antibody, PP432 antibody, REEP-4 antibody, FLJ22277 antibody, REEP-4
Specificity REEP4 antibody was raised against the N terminal of REEP4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE
Assay Information REEP4 Blocking Peptide, catalog no. 33R-2476, is also available for use as a blocking control in assays to test for specificity of this REEP4 antibody

Images

Western Blot analysis using REEP4 antibody (70R-7356)

REEP4 antibody (70R-7356) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of REEP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance REEP4 belongs to the DP1 family. It may enhance the cell surface expression of odorant receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using REEP4 antibody (70R-7356) | REEP4 antibody (70R-7356) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors