RER1 antibody (70R-6861)

Rabbit polyclonal RER1 antibody

Synonyms Polyclonal RER1 antibody, Anti-RER1 antibody, RER-1, RER 1 antibody, Rer1 Retention In Endoplasmic Reticulum 1 Homolog antibody, RP4-740C4.2 antibody, RER 1, RER-1 antibody, RER1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF
Assay Information RER1 Blocking Peptide, catalog no. 33R-3349, is also available for use as a blocking control in assays to test for specificity of this RER1 antibody

Images

Western Blot analysis using RER1 antibody (70R-6861)

RER1 antibody (70R-6861) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RER1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RER1 antibody (70R-6861) | RER1 antibody (70R-6861) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors