RFPL2 antibody (70R-3277)

Rabbit polyclonal RFPL2 antibody raised against the C terminal of RFPL2

Synonyms Polyclonal RFPL2 antibody, Anti-RFPL2 antibody, Ret Finger Protein-Like 2 antibody, RFPL 2 antibody, RFPL2, RFPL 2, RFPL-2, RNF79 antibody, RFPL-2 antibody
Specificity RFPL2 antibody was raised against the C terminal of RFPL2
Cross Reactivity Human
Applications WB
Immunogen RFPL2 antibody was raised using the C terminal of RFPL2 corresponding to a region with amino acids VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG
Assay Information RFPL2 Blocking Peptide, catalog no. 33R-9802, is also available for use as a blocking control in assays to test for specificity of this RFPL2 antibody


Western Blot analysis using RFPL2 antibody (70R-3277)

RFPL2 antibody (70R-3277) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RFPL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RFPL2 antibody (70R-3277) | RFPL2 antibody (70R-3277) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors