RFT1 antibody (70R-5706)

Rabbit polyclonal RFT1 antibody

Synonyms Polyclonal RFT1 antibody, Anti-RFT1 antibody, RFT1, Rft1 Homolog antibody, RFT 1 antibody, RFT 1, RFT-1, RFT-1 antibody
Cross Reactivity Human
Applications WB
Immunogen RFT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV
Assay Information RFT1 Blocking Peptide, catalog no. 33R-3615, is also available for use as a blocking control in assays to test for specificity of this RFT1 antibody


Western Blot analysis using RFT1 antibody (70R-5706)

RFT1 antibody (70R-5706) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RFT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of aMan(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RFT1 antibody (70R-5706) | RFT1 antibody (70R-5706) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors