RGS10 antibody (70R-3699)

Rabbit polyclonal RGS10 antibody raised against the middle region of RGS10

Synonyms Polyclonal RGS10 antibody, Anti-RGS10 antibody, RGS 10, RGS-10 antibody, Regulator Of G-Protein Signalling 10 antibody, RGS10, RGS-10, RGS 10 antibody
Specificity RGS10 antibody was raised against the middle region of RGS10
Cross Reactivity Human
Applications WB
Immunogen RGS10 antibody was raised using the middle region of RGS10 corresponding to a region with amino acids DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Images

Western blot analysis using RGS10 antibody (70R-3699)

Recommended RGS10 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RGS10 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It associates specifically with the activated forms of the G protein subunits G(I)-ALPHA and G(Z)- alpha but fails to interact with the structurally and functionally distinct G(S)-alpha subunit. Activity on G(Z)-alpha is inhibited by palmitoylation of the G-protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using RGS10 antibody (70R-3699) | Recommended RGS10 Antibody Titration: 0.2-1 ug/ml
  • Flow cytometric assay using RGS10 antibody (70R-3699) | Bone marrow derived monocytes

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors