RGS11 antibody (70R-5810)

Rabbit polyclonal RGS11 antibody raised against the middle region of RGS11

Synonyms Polyclonal RGS11 antibody, Anti-RGS11 antibody, Regulator Of G-Protein Signaling 11 antibody, RGS 11, RGS11, RS11 antibody, RGS-11 antibody, RGS 11 antibody, RGS-11
Specificity RGS11 antibody was raised against the middle region of RGS11
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RGS11 antibody was raised using the middle region of RGS11 corresponding to a region with amino acids LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR
Assay Information RGS11 Blocking Peptide, catalog no. 33R-5382, is also available for use as a blocking control in assays to test for specificity of this RGS11 antibody

Images

Western Blot analysis using RGS11 antibody (70R-5810)

RGS11 antibody (70R-5810) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RGS11 belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RGS11 antibody (70R-5810) | RGS11 antibody (70R-5810) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors