RGS19 antibody (70R-5754)

Rabbit polyclonal RGS19 antibody raised against the N terminal of RGS19

Synonyms Polyclonal RGS19 antibody, Anti-RGS19 antibody, RGS 19, RGS-19 antibody, RGSGAIP antibody, RGS 19 antibody, GAIP antibody, Regulator Of G-Protein Signaling 19 antibody, RGS19, RGS-19
Specificity RGS19 antibody was raised against the N terminal of RGS19
Cross Reactivity Human
Applications WB
Immunogen RGS19 antibody was raised using the N terminal of RGS19 corresponding to a region with amino acids PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW
Assay Information RGS19 Blocking Peptide, catalog no. 33R-7391, is also available for use as a blocking control in assays to test for specificity of this RGS19 antibody


Western Blot analysis using RGS19 antibody (70R-5754)

RGS19 antibody (70R-5754) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.G proteins mediate a number of cellular processes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RGS19 antibody (70R-5754) | RGS19 antibody (70R-5754) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors