RGS22 antibody (70R-3489)

Rabbit polyclonal RGS22 antibody raised against the N terminal of RGS22

Synonyms Polyclonal RGS22 antibody, Anti-RGS22 antibody, RGS 22, FLJ40080 antibody, RGS-22, RGS 22 antibody, FLJ75004 antibody, Regulator Of G-Protein Signaling 22 antibody, DKFZp434I092 antibody, PRTD-NY2 antibody, RGS22, MGC102908 antibody, RGS-22 antibody
Specificity RGS22 antibody was raised against the N terminal of RGS22
Cross Reactivity Human
Applications WB
Immunogen RGS22 antibody was raised using the N terminal of RGS22 corresponding to a region with amino acids QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI
Assay Information RGS22 Blocking Peptide, catalog no. 33R-7764, is also available for use as a blocking control in assays to test for specificity of this RGS22 antibody


Western Blot analysis using RGS22 antibody (70R-3489)

RGS22 antibody (70R-3489) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 147 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RGS22 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RGS22 antibody (70R-3489) | RGS22 antibody (70R-3489) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors