RGS3 antibody (70R-5723)

Rabbit polyclonal RGS3 antibody raised against the C terminal of RGS3

Synonyms Polyclonal RGS3 antibody, Anti-RGS3 antibody, RGS3, RGS-3 antibody, RGP3 antibody, FLJ31516 antibody, Regulator Of G-Protein Signaling 3 antibody, RGS 3, RGS-3, FLJ90496 antibody, FLJ20370 antibody, C2PA antibody, PDZ-RGS3 antibody, RGS 3 antibody
Specificity RGS3 antibody was raised against the C terminal of RGS3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Assay Information RGS3 Blocking Peptide, catalog no. 33R-4300, is also available for use as a blocking control in assays to test for specificity of this RGS3 antibody

Images

Western Blot analysis using RGS3 antibody (70R-5723)

Western Blot showing RGS3 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 101 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RGS3 antibody (70R-5723) | Western Blot showing RGS3 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors