RGS4 antibody (70R-5834)

Rabbit polyclonal RGS4 antibody raised against the C terminal of RGS4

Synonyms Polyclonal RGS4 antibody, Anti-RGS4 antibody, RGS 4, Regulator Of G-Protein Signalling 4 antibody, RGS-4 antibody, MGC60244 antibody, RGS4, MGC2124 antibody, RGP4 antibody, RGS 4 antibody, RGS-4
Specificity RGS4 antibody was raised against the C terminal of RGS4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RGS4 antibody was raised using the C terminal of RGS4 corresponding to a region with amino acids EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL
Assay Information RGS4 Blocking Peptide, catalog no. 33R-2276, is also available for use as a blocking control in assays to test for specificity of this RGS4 antibody

Images

Western Blot analysis using RGS4 antibody (70R-5834)

RGS4 antibody (70R-5834) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein negatively regulates signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RGS4 antibody (70R-5834) | RGS4 antibody (70R-5834) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors