RGS6 antibody (70R-5829)

Rabbit polyclonal RGS6 antibody raised against the N terminal of RGS6

Synonyms Polyclonal RGS6 antibody, Anti-RGS6 antibody, RGS 6 antibody, DKFZp313G1241 antibody, GAP antibody, FLJ43552 antibody, MGC142132 antibody, RGS6, RGS 6, Regulator Of G-Protein Signaling 6 antibody, RGS-6 antibody, RGS-6
Specificity RGS6 antibody was raised against the N terminal of RGS6
Cross Reactivity Human,Rat
Applications WB
Immunogen RGS6 antibody was raised using the N terminal of RGS6 corresponding to a region with amino acids AQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKS
Assay Information RGS6 Blocking Peptide, catalog no. 33R-1447, is also available for use as a blocking control in assays to test for specificity of this RGS6 antibody


Western Blot analysis using RGS6 antibody (70R-5829)

RGS6 antibody (70R-5829) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RGS6 antibody (70R-5829) | RGS6 antibody (70R-5829) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors