RGS6 antibody (70R-5830)

Rabbit polyclonal RGS6 antibody raised against the C terminal of RGS6

Synonyms Polyclonal RGS6 antibody, Anti-RGS6 antibody, Regulator Of G-Protein Signalling 6 antibody, RGS 6, RGS-6 antibody, RGS-6, RGS6, RGS 6 antibody
Specificity RGS6 antibody was raised against the C terminal of RGS6
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen RGS6 antibody was raised using the C terminal of RGS6 corresponding to a region with amino acids SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY
Assay Information RGS6 Blocking Peptide, catalog no. 33R-8297, is also available for use as a blocking control in assays to test for specificity of this RGS6 antibody

Images

Immunohistochemical staining using RGS6 antibody (70R-5830)

RGS6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using RGS6 antibody (70R-5830) | RGS6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using RGS6 antibody (70R-5830) | RGS6 antibody (70R-5830) used at 2 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors