RGS9 antibody (70R-5843)

Rabbit polyclonal RGS9 antibody raised against the middle region of RGS9

Synonyms Polyclonal RGS9 antibody, Anti-RGS9 antibody, MGC111763 antibody, RGS-9, RGS 9, RGS9L antibody, RGS9, RGS-9 antibody, MGC26458 antibody, Regulator Of G-Protein Signaling 9 antibody, PERRS antibody, RGS 9 antibody
Specificity RGS9 antibody was raised against the middle region of RGS9
Cross Reactivity Human
Applications WB
Immunogen RGS9 antibody was raised using the middle region of RGS9 corresponding to a region with amino acids LKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWES
Assay Information RGS9 Blocking Peptide, catalog no. 33R-5105, is also available for use as a blocking control in assays to test for specificity of this RGS9 antibody

Images

Western blot analysis using RGS9 antibody (70R-5843)

Recommended RGS9 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using RGS9 antibody (70R-5843) | Recommended RGS9 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors