RHBDF1 antibody (70R-6632)

Rabbit polyclonal RHBDF1 antibody

Synonyms Polyclonal RHBDF1 antibody, Anti-RHBDF1 antibody, RHBDF1, gene -90 antibody, RHBDF-1, RHBDF 1 antibody, EGFR-RS antibody, RHBDF-1 antibody, FLJ22357 antibody, C16orf8 antibody, gene -89 antibody, Rhomboid 5 Homolog 1 antibody, Dist1 antibody, hDist1 antibody, FLJ2235 antibody, RHBDF 1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR
Assay Information RHBDF1 Blocking Peptide, catalog no. 33R-4310, is also available for use as a blocking control in assays to test for specificity of this RHBDF1 antibody

Images

Western Blot analysis using RHBDF1 antibody (70R-6632)

RHBDF1 antibody (70R-6632) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHBDF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RHBDF1 antibody (70R-6632) | RHBDF1 antibody (70R-6632) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors