RHBDL2 antibody (70R-6880)

Rabbit polyclonal RHBDL2 antibody

Synonyms Polyclonal RHBDL2 antibody, Anti-RHBDL2 antibody, Rhomboid Veinlet-Like 2 antibody, RRP2 antibody, RHBDL2, RHBDL 2 antibody, MGC16997 antibody, RHBDL-2, RHBDL-2 antibody, RHBDL 2
Cross Reactivity Human
Applications WB
Immunogen RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT
Assay Information RHBDL2 Blocking Peptide, catalog no. 33R-4732, is also available for use as a blocking control in assays to test for specificity of this RHBDL2 antibody


Western Blot analysis using RHBDL2 antibody (70R-6880)

RHBDL2 antibody (70R-6880) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHBDL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RHBDL2 antibody (70R-6880) | RHBDL2 antibody (70R-6880) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors