RHBG antibody (70R-6759)

Rabbit polyclonal RHBG antibody

Synonyms Polyclonal RHBG antibody, Anti-RHBG antibody, SLC42A2 antibody, Rh Family B Glycoprotein antibody
Cross Reactivity Human
Applications WB
Immunogen RHBG antibody was raised using a synthetic peptide corresponding to a region with amino acids RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR
Assay Information RHBG Blocking Peptide, catalog no. 33R-8279, is also available for use as a blocking control in assays to test for specificity of this RHBG antibody

Images

Western Blot analysis using RHBG antibody (70R-6759)

RHBG antibody (70R-6759) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHBG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RHBG antibody (70R-6759) | RHBG antibody (70R-6759) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors