RHCE antibody (70R-7493)

Rabbit polyclonal RHCE antibody raised against the N terminal of RHCE

Synonyms Polyclonal RHCE antibody, Anti-RHCE antibody, Rh4 antibody, RH antibody, RhVIII antibody, RHPI antibody, RHE antibody, RhIVb(J) antibody, MGC103977 antibody, CD240CE antibody, RHIXB antibody, Rh Blood Group Ccee Antigens antibody, RHC antibody, RH30A antibody, RhVI antibody
Specificity RHCE antibody was raised against the N terminal of RHCE
Cross Reactivity Human
Applications WB
Immunogen RHCE antibody was raised using the N terminal of RHCE corresponding to a region with amino acids SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG
Assay Information RHCE Blocking Peptide, catalog no. 33R-8819, is also available for use as a blocking control in assays to test for specificity of this RHCE antibody

Images

Western Blot analysis using RHCE antibody (70R-7493)

RHCE antibody (70R-7493) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHCE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RHCE antibody (70R-7493) | RHCE antibody (70R-7493) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors