RHEB antibody (70R-5794)

Rabbit polyclonal RHEB antibody raised against the middle region of RHEB

Synonyms Polyclonal RHEB antibody, Anti-RHEB antibody, Ras Homolog Enriched In Brain antibody, MGC111559 antibody, RHEB2 antibody
Specificity RHEB antibody was raised against the middle region of RHEB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RHEB antibody was raised using the middle region of RHEB corresponding to a region with amino acids VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA
Assay Information RHEB Blocking Peptide, catalog no. 33R-9564, is also available for use as a blocking control in assays to test for specificity of this RHEB antibody

Images

Western Blot analysis using RHEB antibody (70R-5794)

RHEB antibody (70R-5794) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHEB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RHEB antibody (70R-5794) | RHEB antibody (70R-5794) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors