RHOA antibody (70R-5840)

Rabbit polyclonal RHOA antibody raised against the middle region of RHOA

Synonyms Polyclonal RHOA antibody, Anti-RHOA antibody, Ras Homolog Gene Family Member A antibody, ARH12 antibody, ARHA antibody, RHOH12 antibody, RHO12 antibody
Specificity RHOA antibody was raised against the middle region of RHOA
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen RHOA antibody was raised using the middle region of RHOA corresponding to a region with amino acids GRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Assay Information RHOA Blocking Peptide, catalog no. 33R-3522, is also available for use as a blocking control in assays to test for specificity of this RHOA antibody

Images

Western blot analysis using RHOA antibody (70R-5840)

Recommended RHOA Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. RHOA serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. It may be an activator of PLCE1. RHOA is activated by ARHGEF2, which promotes the exchange of GDP for GTP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using RHOA antibody (70R-5840) | Recommended RHOA Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors