RHOB antibody (70R-4030)

Rabbit polyclonal RHOB antibody raised against the middle region of RHOB

Synonyms Polyclonal RHOB antibody, Anti-RHOB antibody, RHOH6 antibody, MSTP081 antibody, Ras Homolog Gene Family Member B antibody, ARHB antibody, MST081 antibody, ARH6 antibody
Specificity RHOB antibody was raised against the middle region of RHOB
Cross Reactivity Human
Applications WB
Immunogen RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY
Assay Information RHOB Blocking Peptide, catalog no. 33R-1769, is also available for use as a blocking control in assays to test for specificity of this RHOB antibody

Images

Western blot analysis using RHOB antibody (70R-4030)

Recommended RHOB Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHOB mediates apoptosis in neoplastically transformed cells after DNA damage.RHOB is not essential for development but affects cell adhesion and growth factor signaling in transformed cells.RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. RHOB is involved in intracellular protein trafficking of a number of proteins.RHOB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using RHOB antibody (70R-4030) | Recommended RHOB Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors