RHOC antibody (70R-5758)

Rabbit polyclonal RHOC antibody raised against the N terminal of RHOC

Synonyms Polyclonal RHOC antibody, Anti-RHOC antibody, H9 antibody, MGC61427 antibody, MGC1448 antibody, Ras Homolog Gene Family Member C antibody, ARH9 antibody, RHOH9 antibody, ARHC antibody
Specificity RHOC antibody was raised against the N terminal of RHOC
Cross Reactivity Human,Mouse,Rat,Dog,C.elegans,Drosophila
Applications WB
Immunogen RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF
Assay Information RHOC Blocking Peptide, catalog no. 33R-9740, is also available for use as a blocking control in assays to test for specificity of this RHOC antibody

Images

Western Blot analysis using RHOC antibody (70R-5758)

RHOC antibody (70R-5758) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RHOC antibody (70R-5758) | RHOC antibody (70R-5758) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors