RHOD antibody (70R-5765)

Rabbit polyclonal RHOD antibody raised against the N terminal of RHOD

Synonyms Polyclonal RHOD antibody, Anti-RHOD antibody, Ras Homolog Gene Family Member D antibody, ARHD antibody, RHOM antibody, RHOHP1 antibody, Rho antibody
Specificity RHOD antibody was raised against the N terminal of RHOD
Cross Reactivity Human
Applications WB
Immunogen RHOD antibody was raised using the N terminal of RHOD corresponding to a region with amino acids TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF
Assay Information RHOD Blocking Peptide, catalog no. 33R-8964, is also available for use as a blocking control in assays to test for specificity of this RHOD antibody


Western Blot analysis using RHOD antibody (70R-5765)

RHOD antibody (70R-5765) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RHOD antibody (70R-5765) | RHOD antibody (70R-5765) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors