RHOJ antibody (70R-4532)

Rabbit polyclonal RHOJ antibody raised against the middle region of RHOJ

Synonyms Polyclonal RHOJ antibody, Anti-RHOJ antibody, MGC34777 antibody, RASL7B antibody, FLJ14445 antibody, TC10B antibody, Ras Homolog Gene Family Member J antibody, TCL antibody, ARHJ antibody
Specificity RHOJ antibody was raised against the middle region of RHOJ
Cross Reactivity Human
Applications WB
Immunogen RHOJ antibody was raised using the middle region of RHOJ corresponding to a region with amino acids LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
Assay Information RHOJ Blocking Peptide, catalog no. 33R-4988, is also available for use as a blocking control in assays to test for specificity of this RHOJ antibody


Western Blot analysis using RHOJ antibody (70R-4532)

RHOJ antibody (70R-4532) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOJ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RHOJ antibody (70R-4532) | RHOJ antibody (70R-4532) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors