RHOT1 antibody (70R-6517)

Rabbit polyclonal RHOT1 antibody raised against the N terminal of RHOT1

Synonyms Polyclonal RHOT1 antibody, Anti-RHOT1 antibody, FLJ11040 antibody, ARHT1 antibody, Ras Homolog Gene Family Member T1 antibody, RHOT 1, FLJ12633 antibody, RHOT 1 antibody, RHOT-1 antibody, MIRO-1 antibody, RHOT1, RHOT-1
Specificity RHOT1 antibody was raised against the N terminal of RHOT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids EMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDV
Assay Information RHOT1 Blocking Peptide, catalog no. 33R-2585, is also available for use as a blocking control in assays to test for specificity of this RHOT1 antibody

Images

Western Blot analysis using RHOT1 antibody (70R-6517)

RHOT1 antibody (70R-6517) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RHOT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RHOT1 is mitochondrial GTPase involved in mitochondrial trafficking. It is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RHOT1 antibody (70R-6517) | RHOT1 antibody (70R-6517) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors