Ribophorin I antibody (70R-7108)

Rabbit polyclonal Ribophorin I antibody raised against the middle region of RPN1

Synonyms Polyclonal Ribophorin I antibody, Anti-Ribophorin I antibody, RBPH1 antibody, OST1 antibody, DKFZp686B16177 antibody, RPN1 antibody
Specificity Ribophorin I antibody was raised against the middle region of RPN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Ribophorin I antibody was raised using the middle region of RPN1 corresponding to a region with amino acids AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK
Assay Information Ribophorin I Blocking Peptide, catalog no. 33R-1015, is also available for use as a blocking control in assays to test for specificity of this Ribophorin I antibody

Images

Western Blot analysis using Ribophorin I antibody (70R-7108)

Ribophorin I antibody (70R-7108) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Ribophorin I antibody (70R-7108) | Ribophorin I antibody (70R-7108) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors