Ribophorin II antibody (70R-6845)

Rabbit polyclonal Ribophorin II antibody raised against the middle region of RPN2

Synonyms Polyclonal Ribophorin II antibody, Anti-Ribophorin II antibody, RPNII antibody, SWP1 antibody, RIBIIR antibody, RPN-II antibody, RPN2 antibody
Specificity Ribophorin II antibody was raised against the middle region of RPN2
Cross Reactivity Human
Applications WB
Immunogen Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP
Assay Information Ribophorin II Blocking Peptide, catalog no. 33R-4018, is also available for use as a blocking control in assays to test for specificity of this Ribophorin II antibody

Images

Western Blot analysis using Ribophorin II antibody (70R-6845)

Ribophorin II antibody (70R-6845) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Ribophorin II antibody (70R-6845) | Ribophorin II antibody (70R-6845) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors