RIC8A antibody (70R-4511)

Rabbit polyclonal RIC8A antibody

Synonyms Polyclonal RIC8A antibody, Anti-RIC8A antibody, MGC131931 antibody, RICA-8 antibody, RIC8A, MGC148074 antibody, RICA 8 antibody, MGC148073 antibody, MGC104517 antibody, synembryn antibody, Resistance To Inhibitors Of Cholinesterase 8 Homolog A antibody, RICA 8, RICA-8, RIC8 antibody
Cross Reactivity Human
Applications WB
Immunogen RIC8A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL
Assay Information RIC8A Blocking Peptide, catalog no. 33R-4543, is also available for use as a blocking control in assays to test for specificity of this RIC8A antibody

Images

Western Blot analysis using RIC8A antibody (70R-4511)

RIC8A antibody (70R-4511) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RIC8A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RIC8A is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins.RIC8A is able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP.RIC8A is involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. RIC8A also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RIC8A antibody (70R-4511) | RIC8A antibody (70R-4511) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors