Ricin Acyl CoA binding protein (His tag) (80-1054)

Purified recombinant Ricin Acyl CoA binding protein (His tag)

Synonyms Acyl-CoA binding protein, Acyl CoA binding protein, AcylCoA binding protein, Ricinus communis binding protein, Ricin binding protein, ACBP protein, Ricinus communis Acyl CoA binding protein, Ricin ACBP protein
Species Ricinus communis
Protein Type Recombinant

Specifications

Residues AA sequence: MGLKEDFEEHAEKAKTLPENTTNENKLILY GLYKQATVGPVNTSRPGMFNMRDRAKWDAWKAVEGKSTE EAMSDYITKVKQLLGEAAASA Expression Region: 1-90
Expression System E.coli
Purity > 90% pure
Tag/Conjugate His tag
Form & Buffer Supplied in PBS buffer, pH 7.4and50% glycerol

Storage & Safety

Storage Store at -20 deg C short term and -20 to -80 degC long term. Repeated freezing and thawing is not recommended. Store working aliquots at4 deg Cfor up to one week.

General Information

Biological Significance The Ricin Acyl CoA binding protein binds medium and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $325.00
Size: 200 ug
OR
Shipping
View Our Distributors