RIOK2 antibody (70R-3721)

Rabbit polyclonal RIOK2 antibody

Synonyms Polyclonal RIOK2 antibody, Anti-RIOK2 antibody, RIOK-2, RIOK 2 antibody, FLJ11159 antibody, RIOK 2, RIOK-2 antibody, Rio Kinase 2 antibody, RIOK2
Cross Reactivity Human
Applications WB
Immunogen RIOK2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDYNRHAVVMELINGYPLCQIHHVEDPASVYDEAMELIVKLANHGLIHGD
Assay Information RIOK2 Blocking Peptide, catalog no. 33R-3933, is also available for use as a blocking control in assays to test for specificity of this RIOK2 antibody

Images

Western Blot analysis using RIOK2 antibody (70R-3721)

RIOK2 antibody (70R-3721) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RIOK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RIOK2 may be involved in transferase activity, protein serine/threonine kinase activity, nucleotide binding, kinase activity and ATP binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RIOK2 antibody (70R-3721) | RIOK2 antibody (70R-3721) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors