RIPK4 antibody (70R-3442)

Rabbit polyclonal RIPK4 antibody raised against the N terminal of RIPK4

Synonyms Polyclonal RIPK4 antibody, Anti-RIPK4 antibody, PKK antibody, RIPK-4 antibody, ANKRD3 antibody, RIPK-4, RIP4 antibody, MGC129993 antibody, DIK antibody, RIPK 4, ANKK2 antibody, RIPK4, Receptor-Interacting Serine-Threonine Kinase 4 antibody, MGC129992 antibody, RIPK 4 antibody
Specificity RIPK4 antibody was raised against the N terminal of RIPK4
Cross Reactivity Human
Applications WB
Immunogen RIPK4 antibody was raised using the N terminal of RIPK4 corresponding to a region with amino acids DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN
Assay Information RIPK4 Blocking Peptide, catalog no. 33R-1956, is also available for use as a blocking control in assays to test for specificity of this RIPK4 antibody


Western Blot analysis using RIPK4 antibody (70R-3442)

RIPK4 antibody (70R-3442) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RIPK4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RIPK4 is a serine/threonine protein kinase that interacts with protein kinase C-delta. The protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RIPK4 antibody (70R-3442) | RIPK4 antibody (70R-3442) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors