RMI1 antibody (70R-5555)

Rabbit polyclonal RMI1 antibody

Synonyms Polyclonal RMI1 antibody, Anti-RMI1 antibody, FLJ12888 antibody, RMI 1 antibody, C9orf76 antibody, RMI-1 antibody, BLAP75 antibody, RMI-1, RP11-346I8.1 antibody, RMI1, Rmi1 Recq Mediated Genome Instability 1 Homolog antibody, RMI 1
Cross Reactivity Human,Mouse
Applications WB
Immunogen RMI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA
Assay Information RMI1 Blocking Peptide, catalog no. 33R-1953, is also available for use as a blocking control in assays to test for specificity of this RMI1 antibody


Western Blot analysis using RMI1 antibody (70R-5555)

RMI1 antibody (70R-5555) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RMI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RMI1 antibody (70R-5555) | RMI1 antibody (70R-5555) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors