RMND1 antibody (70R-4357)

Rabbit polyclonal RMND1 antibody

Synonyms Polyclonal RMND1 antibody, Anti-RMND1 antibody, RMND 1, RMND1, MGC117362 antibody, RMND-1, C6orf96 antibody, RMND 1 antibody, FLJ20627 antibody, bA351K16 antibody, bA351K16.3 antibody, RMND-1 antibody, MGC88260 antibody, MGC149570 antibody, RMD1 antibody, Required For Meiotic Nuclear Division 1 Homolog antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen RMND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL
Assay Information RMND1 Blocking Peptide, catalog no. 33R-4909, is also available for use as a blocking control in assays to test for specificity of this RMND1 antibody

Images

Western Blot analysis using RMND1 antibody (70R-4357)

RMND1 antibody (70R-4357) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RMND1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RMND1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RMND1 antibody (70R-4357) | RMND1 antibody (70R-4357) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors