RNASE1 antibody (70R-7106)

Rabbit polyclonal RNASE1 antibody

Synonyms Polyclonal RNASE1 antibody, Anti-RNASE1 antibody, Pancreatic antibody, Ribonuclease Rnase A Family 1 antibody, RNS1 antibody, RIB1 antibody, MGC12408 antibody
Cross Reactivity Human
Applications WB
Immunogen RNASE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
Assay Information RNASE1 Blocking Peptide, catalog no. 33R-6094, is also available for use as a blocking control in assays to test for specificity of this RNASE1 antibody

Images

Western Blot analysis using RNASE1 antibody (70R-7106)

RNASE1 antibody (70R-7106) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNASE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNASE1 antibody (70R-7106) | RNASE1 antibody (70R-7106) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors