RNASE11 antibody (70R-5391)

Rabbit polyclonal RNASE11 antibody

Synonyms Polyclonal RNASE11 antibody, Anti-RNASE11 antibody, Ribonuclease Rnase A Family 11 antibody, C14orf6 antibody
Cross Reactivity Human
Applications WB
Immunogen RNASE11 antibody was raised using a synthetic peptide corresponding to a region with amino acids GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL
Assay Information RNASE11 Blocking Peptide, catalog no. 33R-3344, is also available for use as a blocking control in assays to test for specificity of this RNASE11 antibody

Images

Western Blot analysis using RNASE11 antibody (70R-5391)

RNASE11 antibody (70R-5391) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNASE11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNASE11 belongs to the pancreatic ribonuclease family. The function of RNASE11 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNASE11 antibody (70R-5391) | RNASE11 antibody (70R-5391) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors