RNASEH1 antibody (70R-5021)

Rabbit polyclonal RNASEH1 antibody raised against the middle region of RNASEH1

Synonyms Polyclonal RNASEH1 antibody, Anti-RNASEH1 antibody, H1RNA antibody, Ribonuclease H1 antibody
Specificity RNASEH1 antibody was raised against the middle region of RNASEH1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RNASEH1 antibody was raised using the middle region of RNASEH1 corresponding to a region with amino acids EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Assay Information RNASEH1 Blocking Peptide, catalog no. 33R-2790, is also available for use as a blocking control in assays to test for specificity of this RNASEH1 antibody


Western Blot analysis using RNASEH1 antibody (70R-5021)

RNASEH1 antibody (70R-5021) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNASEH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNASEH1 belongs to the RNase H family. It contains 1 RNase H domain. RNASEH1 is an endonuclease that specifically degrades the RNA of RNA-DNA hybrids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNASEH1 antibody (70R-5021) | RNASEH1 antibody (70R-5021) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors