RNASEH2A antibody (70R-5650)

Rabbit polyclonal RNASEH2A antibody raised against the C terminal of RNASEH2A

Synonyms Polyclonal RNASEH2A antibody, Anti-RNASEH2A antibody, RNASEHI antibody, Ribonuclease H2 Subunit A antibody, RNHIA antibody, RNHL antibody, JUNB antibody
Specificity RNASEH2A antibody was raised against the C terminal of RNASEH2A
Cross Reactivity Human
Applications IHC, WB
Immunogen RNASEH2A antibody was raised using the C terminal of RNASEH2A corresponding to a region with amino acids EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES
Assay Information RNASEH2A Blocking Peptide, catalog no. 33R-2500, is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody

Images

Immunohistochemical staining using RNASEH2A antibody (70R-5650)

RNASEH2A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNASEH2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using RNASEH2A antibody (70R-5650) | RNASEH2A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using RNASEH2A antibody (70R-5650) | RNASEH2A antibody (70R-5650) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors