RNASEN antibody (70R-4643)

Rabbit polyclonal RNASEN antibody raised against the middle region of RNASEN

Synonyms Polyclonal RNASEN antibody, Anti-RNASEN antibody, RANSE3L antibody, RN3 antibody, HSA242976 antibody, RNASE3L antibody, DROSHA antibody, ETOHI2 antibody, Ribonuclease Type Iii Nuclear antibody
Specificity RNASEN antibody was raised against the middle region of RNASEN
Cross Reactivity Human
Applications WB
Immunogen RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK
Assay Information RNASEN Blocking Peptide, catalog no. 33R-1038, is also available for use as a blocking control in assays to test for specificity of this RNASEN antibody

Images

Western Blot analysis using RNASEN antibody (70R-4643)

RNASEN antibody (70R-4643) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 159 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNASEN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNASEN is a ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNASEN antibody (70R-4643) | RNASEN antibody (70R-4643) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors