RNASET2 antibody (70R-5020)

Rabbit polyclonal RNASET2 antibody raised against the middle region of RNASET2

Synonyms Polyclonal RNASET2 antibody, Anti-RNASET2 antibody, RNASE6PL antibody, bA514O12.3 antibody, Ribonuclease T2 antibody
Specificity RNASET2 antibody was raised against the middle region of RNASET2
Cross Reactivity Human
Applications WB
Immunogen RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
Assay Information RNASET2 Blocking Peptide, catalog no. 33R-8208, is also available for use as a blocking control in assays to test for specificity of this RNASET2 antibody


Western Blot analysis using RNASET2 antibody (70R-5020)

RNASET2 antibody (70R-5020) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNASET2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNASET2 antibody (70R-5020) | RNASET2 antibody (70R-5020) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors