RNF121 antibody (70R-6550)

Rabbit polyclonal RNF121 antibody raised against the middle region of RNF121

Synonyms Polyclonal RNF121 antibody, Anti-RNF121 antibody, RNF 121, RNF 121 antibody, Ring Finger Protein 121 antibody, RNF-121 antibody, RNF121, FLJ11099 antibody, RNF-121
Specificity RNF121 antibody was raised against the middle region of RNF121
Cross Reactivity Human
Applications WB
Immunogen RNF121 antibody was raised using the middle region of RNF121 corresponding to a region with amino acids GMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWC
Assay Information RNF121 Blocking Peptide, catalog no. 33R-3438, is also available for use as a blocking control in assays to test for specificity of this RNF121 antibody

Images

Western Blot analysis using RNF121 antibody (70R-6550)

RNF121 antibody (70R-6550) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF121 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. Three of them are supported by at least two independent transcripts or ESTs, the full length natures of others are not clear.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF121 antibody (70R-6550) | RNF121 antibody (70R-6550) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors