RNF144B antibody (70R-6351)

Rabbit polyclonal RNF144B antibody raised against the middle region of RNF144B

Synonyms Polyclonal RNF144B antibody, Anti-RNF144B antibody, MGC71786 antibody, KIAA0161 antibody, bA528A10.3 antibody, RNF144, RNF 144 antibody, IBRDC2 antibody, RNF-144, Ring Finger Protein 144B antibody, RNF 144, RNF-144 antibody, p53RFP antibody
Specificity RNF144B antibody was raised against the middle region of RNF144B
Cross Reactivity Human
Applications WB
Immunogen RNF144B antibody was raised using the middle region of RNF144B corresponding to a region with amino acids KHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVG
Assay Information RNF144B Blocking Peptide, catalog no. 33R-4424, is also available for use as a blocking control in assays to test for specificity of this RNF144B antibody

Images

Western Blot analysis using RNF144B antibody (70R-6351)

RNF144B antibody (70R-6351) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF144B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF144B is an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF144B antibody (70R-6351) | RNF144B antibody (70R-6351) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors