RNF153 antibody (70R-6496)

Rabbit polyclonal RNF153 antibody

Synonyms Polyclonal RNF153 antibody, Anti-RNF153 antibody, RNF-153, RNF153, Membrane-Associated Ring Finger 153 antibody, RNF 153 antibody, MARCH-V antibody, RNF 153, RNF153 antibody, C3Hc4 5 antibody, 38412 antibody, MITOL antibody, RNF-153 antibody, FLJ20445 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RNF153 antibody was raised using a synthetic peptide corresponding to a region with amino acids CRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVY
Assay Information RNF153 Blocking Peptide, catalog no. 33R-1794, is also available for use as a blocking control in assays to test for specificity of this RNF153 antibody


Western Blot analysis using RNF153 antibody (70R-6496)

RNF153 antibody (70R-6496) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 38412 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MARCH5 is an ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 (MFN2) and DRP1 (DNM1L). MARCH5 is a ubiquitin ligase of the mitochondrial outer membrane that plays a role in the control of mitochondrial morphology by regulating mitofusin-2 and DRP1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNF153 antibody (70R-6496) | RNF153 antibody (70R-6496) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors