RNF170 antibody (70R-6285)

Rabbit polyclonal RNF170 antibody raised against the C terminal of RNF170

Synonyms Polyclonal RNF170 antibody, Anti-RNF170 antibody, RNF 170 antibody, RNF-170, Ring Finger Protein 170 antibody, RNF-170 antibody, RNF170, DKFZP564A022 antibody, FLJ38306 antibody, RNF 170
Specificity RNF170 antibody was raised against the C terminal of RNF170
Cross Reactivity Human,Mouse
Applications WB
Immunogen RNF170 antibody was raised using the C terminal of RNF170 corresponding to a region with amino acids FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR
Assay Information RNF170 Blocking Peptide, catalog no. 33R-3138, is also available for use as a blocking control in assays to test for specificity of this RNF170 antibody

Images

Western Blot analysis using RNF170 antibody (70R-6285)

RNF170 antibody (70R-6285) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF170 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF170 antibody (70R-6285) | RNF170 antibody (70R-6285) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors