RNF170 antibody (70R-6665)

Rabbit polyclonal RNF170 antibody raised against the middle region of RNF170

Synonyms Polyclonal RNF170 antibody, Anti-RNF170 antibody, RNF170, Ring Finger Protein 170 antibody, RNF-170 antibody, DKFZP564A022 antibody, FLJ38306 antibody, RNF 170, RNF-170, RNF 170 antibody
Specificity RNF170 antibody was raised against the middle region of RNF170
Cross Reactivity Human
Applications WB
Immunogen RNF170 antibody was raised using the middle region of RNF170 corresponding to a region with amino acids CIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDY
Assay Information RNF170 Blocking Peptide, catalog no. 33R-1717, is also available for use as a blocking control in assays to test for specificity of this RNF170 antibody

Images

Western Blot analysis using RNF170 antibody (70R-6665)

RNF170 antibody (70R-6665) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF170 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF170 antibody (70R-6665) | RNF170 antibody (70R-6665) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors