RNF172 antibody (70R-6286)

Rabbit polyclonal RNF172 antibody

Synonyms Polyclonal RNF172 antibody, Anti-RNF172 antibody, 37316 antibody, RNF-172 antibody, RNF 172, MARCH-II antibody, RNF-172, RNF 172 antibody, HSPC240 antibody, Membrane-Associated Ring Finger 172 antibody, RNF172 antibody, C3Hc4 2 antibody, RNF172
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RNF172 antibody was raised using a synthetic peptide corresponding to a region with amino acids TIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSP
Assay Information RNF172 Blocking Peptide, catalog no. 33R-9112, is also available for use as a blocking control in assays to test for specificity of this RNF172 antibody

Images

Western Blot analysis using RNF172 antibody (70R-6286)

RNF172 antibody (70R-6286) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 37316 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MARCH2 is an E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. MARCH2 may be involved in endosomal trafficking through interaction with STX6.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF172 antibody (70R-6286) | RNF172 antibody (70R-6286) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors