RNF174 antibody (70R-6643)

Rabbit polyclonal RNF174 antibody

Synonyms Polyclonal RNF174 antibody, Anti-RNF174 antibody, Membrane-Associated Ring Finger 174 antibody, RNF174, MGC104908 antibody, MARCH-IV antibody, RNF-174 antibody, RNF 174 antibody, 38047 antibody, RNF-174, RNF 174, RNF174 antibody, C3Hc4 4 antibody
Cross Reactivity Human
Applications WB
Immunogen RNF174 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQPPGLAANNTLPALGAG
Assay Information RNF174 Blocking Peptide, catalog no. 33R-3405, is also available for use as a blocking control in assays to test for specificity of this RNF174 antibody

Images

Western Blot analysis using RNF174 antibody (70R-6643)

RNF174 antibody (70R-6643) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 38047 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MARCH4 is an E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I and CD4, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF174 antibody (70R-6643) | RNF174 antibody (70R-6643) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors