RNF178 antibody (70R-6420)

Rabbit polyclonal RNF178 antibody

Synonyms Polyclonal RNF178 antibody, Anti-RNF178 antibody, MARCH-VIII antibody, Membrane-Associated Ring Finger 178 antibody, RNF-178 antibody, MIR antibody, c-MIR antibody, RNF178, RNF 178 antibody, C3Hc4 8 antibody, RNF-178, RNF 178, 39508 antibody, RNF178 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RNF178 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHG
Assay Information RNF178 Blocking Peptide, catalog no. 33R-10283, is also available for use as a blocking control in assays to test for specificity of this RNF178 antibody

Images

Western Blot analysis using RNF178 antibody (70R-6420)

RNF178 antibody (70R-6420) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 39508 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MARCH8 is an E3 ubiquitin-protein ligase that may regulate immune responses by promoting ubiquitination of MHC-II and CD86, which leads to their subsequent endocytosis and lysosomal degradation. It may also promote ubiquitination and endocytosis of TFRC and FAS. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF178 antibody (70R-6420) | RNF178 antibody (70R-6420) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors