RNF178 antibody (70R-6955)

Rabbit polyclonal RNF178 antibody

Synonyms Polyclonal RNF178 antibody, Anti-RNF178 antibody, 39508 antibody, MARCH-VIII antibody, RNF 178, RNF-178 antibody, RNF178, MIR antibody, C3Hc4 8 antibody, c-MIR antibody, RNF 178 antibody, RNF-178, RNF178 antibody, Membrane-Associated Ring Finger 178 antibody
Cross Reactivity Human
Applications WB
Immunogen RNF178 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS
Assay Information RNF178 Blocking Peptide, catalog no. 33R-6473, is also available for use as a blocking control in assays to test for specificity of this RNF178 antibody


Western Blot analysis using RNF178 antibody (70R-6955)

RNF178 antibody (70R-6955) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 39508 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC MARCH enzymes add ubiquitin to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNF178 antibody (70R-6955) | RNF178 antibody (70R-6955) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors