RNF182 antibody (70R-6668)

Rabbit polyclonal RNF182 antibody raised against the middle region of RNF182

Synonyms Polyclonal RNF182 antibody, Anti-RNF182 antibody, RNF 182 antibody, RNF182, RNF 182, RNF-182 antibody, FLJ40772 antibody, RNF-182, Ring Finger Protein 182 antibody, MGC33993 antibody
Specificity RNF182 antibody was raised against the middle region of RNF182
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RNF182 antibody was raised using the middle region of RNF182 corresponding to a region with amino acids LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY
Assay Information RNF182 Blocking Peptide, catalog no. 33R-5457, is also available for use as a blocking control in assays to test for specificity of this RNF182 antibody

Images

Western Blot analysis using RNF182 antibody (70R-6668)

RNF182 antibody (70R-6668) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF182 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF182 antibody (70R-6668) | RNF182 antibody (70R-6668) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors