RNF185 antibody (70R-6666)

Rabbit polyclonal RNF185 antibody raised against the middle region of RNF185

Synonyms Polyclonal RNF185 antibody, Anti-RNF185 antibody, FLJ38628 antibody, RNF-185, Ring Finger Protein 185 antibody, RNF185, RNF-185 antibody, RNF 185, RNF 185 antibody
Specificity RNF185 antibody was raised against the middle region of RNF185
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RNF185 antibody was raised using the middle region of RNF185 corresponding to a region with amino acids QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF
Assay Information RNF185 Blocking Peptide, catalog no. 33R-7767, is also available for use as a blocking control in assays to test for specificity of this RNF185 antibody

Images

Western Blot analysis using RNF185 antibody (70R-6666)

RNF185 antibody (70R-6666) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF185 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The exact function of RNF185 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RNF185 antibody (70R-6666) | RNF185 antibody (70R-6666) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors